Protein Info for EX31_RS06630 in Rahnella sp. WP5

Annotation: anaerobic C4-dicarboxylate transporter DcuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 114 to 143 (30 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 310 to 338 (29 residues), see Phobius details amino acids 346 to 377 (32 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF03606: DcuC" amino acids 2 to 452 (451 residues), 484 bits, see alignment E=4.1e-149 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 55 to 442 (388 residues), 566.2 bits, see alignment E=2.3e-174 PF06808: DctM" amino acids 144 to 450 (307 residues), 37 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 100% identity to rah:Rahaq_2121)

Predicted SEED Role

"C4-dicarboxylate transporter DcuC (TC 2.A.61.1.1)" (TC 2.A.61.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>EX31_RS06630 anaerobic C4-dicarboxylate transporter DcuC (Rahnella sp. WP5)
MLELLIGLVVAVFVGRYIIKGYSPTGVLMVGGLLLLIISAIMGHSILPEGTKSTGWNATD
IVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDVVVKLASRPLQMINSPYILMVAA
YILACLMSLAVSSATGLGVLLMATLFPIMVNVGISRGAAAAICASPAAIILSPTSGDVVL
AAQAANMPLVDFAFKVTLPISIAAIAAMAVAHFFWQRYLDKRDTSVLADAVDSNADDVIE
TNAPAFYAILPFTPIIGVLIFDGKWGPNLHIITILVICMLLTALIETVRNRNGKAVFAGL
DVAYRGMADAFANVVMLLVTAGVFAQGLSTVGFISSLIGLAQNFGSGSIVMMLVLVVITV
LAAMTTGSGNASFYAFVELIPKLAAKMGINPEYLVIPMLQASNLGRTISPVSGVIVAVAG
MAKISPFEVVKRTSVPVLVGLIVVIVATEILVPVH