Protein Info for EX31_RS06615 in Rahnella sp. WP5

Annotation: electron transport complex subunit RsxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 3 to 186 (184 residues), 281.4 bits, see alignment E=1.5e-88 PF04060: FeS" amino acids 44 to 75 (32 residues), 44.8 bits, see alignment 2.8e-15 PF12837: Fer4_6" amino acids 108 to 131 (24 residues), 28.3 bits, see alignment (E = 4.4e-10) PF14697: Fer4_21" amino acids 109 to 163 (55 residues), 70.9 bits, see alignment E=2.7e-23 PF12797: Fer4_2" amino acids 109 to 128 (20 residues), 25.3 bits, see alignment (E = 3.6e-09) PF00037: Fer4" amino acids 110 to 131 (22 residues), 32.3 bits, see alignment (E = 2.2e-11) amino acids 140 to 162 (23 residues), 24.1 bits, see alignment (E = 8.1e-09) PF13237: Fer4_10" amino acids 110 to 157 (48 residues), 32.1 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 81% identical to RNFB_SERP5: Ion-translocating oxidoreductase complex subunit B (rnfB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 100% identity to rah:Rahaq_2118)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>EX31_RS06615 electron transport complex subunit RsxB (Rahnella sp. WP5)
MFELWVAIGALTALALVFGLLLGYASRRFAVEGNPVVDQIDDILPQSQCAQCGYPGCKPY
AEAVANGDNINKCVPGGEAVMLKLATLLNVEPQPMGEDAAAAVPVRKVAYIDESNCIGCT
KCIQACPVDAIVGATRAVHTVITDLCTGCDLCVAPCPTDCIEMLPVKTTTANWKWDLKSI
PVQVIHAE