Protein Info for EX31_RS06570 in Rahnella sp. WP5

Annotation: nickel/cobalt efflux protein RcnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 221 to 247 (27 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details PF03824: NicO" amino acids 13 to 288 (276 residues), 162.9 bits, see alignment E=1.1e-51 PF13386: DsbD_2" amino acids 181 to 257 (77 residues), 26.7 bits, see alignment E=4.9e-10

Best Hits

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 100% identity to rah:Rahaq_2109)

Predicted SEED Role

"Nickel/cobalt efflux transporter RcnA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>EX31_RS06570 nickel/cobalt efflux protein RcnA (Rahnella sp. WP5)
MNDFSTLLQQGNAWIFIPSAILLGILHGLEPGHSKTMMAAFIIAIKGTVRQAILLGLAAT
VSHTAIVWIIAFGGMYLSNRFTAEAVEPWLQLVSAVIILGTAAWMFWRTFRGEQLWKKEH
AHGHHADHDHHHGHSHTHANVQRHVQPRGLNNLRGMKRISLSPQEYQDAHELAHASDIER
RFASTEVTNGQILFFGLTGGLIPCPAAITVLLICIQLKQLALGATMVVCFSIGLALTLVT
VGVAAAVSVRQAAKRWSGLNTLARRAPYFSSVLIALVGIYMGIHGVMGLTS