Protein Info for EX31_RS06325 in Rahnella sp. WP5

Annotation: pyrimidine (deoxy)nucleoside triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF00293: NUDIX" amino acids 5 to 124 (120 residues), 73.3 bits, see alignment E=2e-24 PF14815: NUDIX_4" amino acids 9 to 123 (115 residues), 64.7 bits, see alignment E=6.5e-22

Best Hits

Swiss-Prot: 56% identical to NUDG_ECOLI: CTP pyrophosphohydrolase (nudG) from Escherichia coli (strain K12)

KEGG orthology group: K08320, CTP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 98% identity to rah:Rahaq_2058)

MetaCyc: 56% identical to 5-hydroxy-CTP diphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-6957 [EC: 3.6.1.56]; 3.6.1.- [EC: 3.6.1.56]; RXN0-7291 [EC: 3.6.1.56]

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>EX31_RS06325 pyrimidine (deoxy)nucleoside triphosphate diphosphatase (Rahnella sp. WP5)
MTMKTIDVVAALIEREGKLLLARRDASGDQAGLWEFPGGKVEAGESQPAALVRELQEEMG
ITATVEDFIATSVMQQSERLIRLHGWRVSGFTGEIRLQCHSEICWVTPDEVLSFELAPAD
IPLAQAYLAKFTG