Protein Info for EX31_RS06285 in Rahnella sp. WP5

Annotation: peptide-methionine (R)-S-oxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF01641: SelR" amino acids 12 to 127 (116 residues), 177.6 bits, see alignment E=4.1e-57 TIGR00357: methionine-R-sulfoxide reductase" amino acids 12 to 134 (123 residues), 190.4 bits, see alignment E=6.3e-61

Best Hits

Swiss-Prot: 70% identical to MSRB_SERP5: Peptide methionine sulfoxide reductase MsrB (msrB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 99% identity to rah:Rahaq_2050)

MetaCyc: 66% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>EX31_RS06285 peptide-methionine (R)-S-oxide reductase MsrB (Rahnella sp. WP5)
MSIEAKSSPTLEQLTEIQRYVTQEHGTEPPFSGKLLHNRREGIYHCVVCESALFYSDTKY
DSGCGWPSFYQPVNPDAIKYLTDNSHKMARVEIRCSRCEAHLGHVFPDGPKPTGERYCIN
SASMSFTDGKSGNKTRG