Protein Info for EX31_RS06275 in Rahnella sp. WP5

Annotation: D-hexose-6-phosphate mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF01263: Aldose_epim" amino acids 28 to 268 (241 residues), 167.1 bits, see alignment E=3.1e-53

Best Hits

Swiss-Prot: 56% identical to YEAD_ECOLI: Putative glucose-6-phosphate 1-epimerase (yeaD) from Escherichia coli (strain K12)

KEGG orthology group: K01792, glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (inferred from 99% identity to rah:Rahaq_2048)

Predicted SEED Role

"Aldose 1-epimerase family protein YeaD"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>EX31_RS06275 D-hexose-6-phosphate mutarotase (Rahnella sp. WP5)
MTEQLFSLPIVNQISTSVSQRLVDELPVLVVTHPKVRAAIALQGAHLLAWQPEGEEPVLW
MSSASAFKEGVAIRGGIPICWPWFGPAGKPSHGFARNVAWELTDHKETDEDVVLTLTLKS
SPETLELWPHAFTLTARFTLGATCHIELESTGDFEANSALHTYFNIGDIADVTIKGLGNN
FIDKVDGAKAKQEEGDLTFTGQTDRIYTQPQATSEIVDPVLKRTLVVAHENNADVVAWNP
GSALSVSMADMPDDGYKTMVCVETAQVSHTHTSTHAAPARLAVTFSIRK