Protein Info for EX31_RS06270 in Rahnella sp. WP5

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 61% identical to YEAE_ECOLI: Uncharacterized protein YeaE (yeaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_2047)

MetaCyc: 61% identical to methylglyoxal reductase YeaE (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]

Predicted SEED Role

"Putative oxidoreductase YeaE, aldo/keto reductase family"

MetaCyc Pathways

superpathway of methylglyoxal degradation (7/8 steps found)
methylglyoxal degradation III (2/2 steps found)
D-arabinose degradation V (1/3 steps found)
detoxification of reactive carbonyls in chloroplasts (4/10 steps found)
superpathway of pentose and pentitol degradation (13/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>EX31_RS06270 aldo/keto reductase (Rahnella sp. WP5)
MKAKTVQLPDGTTVPAIGQGTWYMGERNSDLRAEVKALQQGLDAGMTLIDTAEMYADGGA
ERVVGEAISGRRDDVFLVSKVYPHHAGGAKAIAACEQSLKRLKTDCIDLYLLHWRGSIPL
HDTVAAMEKLQQSGKIRRWGVSNLDTDDMQALWKIPGGNACMTNQVLYHAAVRGIEFDLL
PWCEEHSVPVMAYCPLAQAGKLRHDVLTAPVMQEIANARGVSSAQIALAWVTRTGNVIAI
PKAVQPQHVKDNAAALTLSLTADEIARIDTVFPAPNHKTPLDMV