Protein Info for EX31_RS06150 in Rahnella sp. WP5

Annotation: transcriptional regulator AsnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13404: HTH_AsnC-type" amino acids 7 to 48 (42 residues), 51.4 bits, see alignment E=1.2e-17 PF13412: HTH_24" amino acids 7 to 54 (48 residues), 51.5 bits, see alignment E=9.1e-18 PF01037: AsnC_trans_reg" amino acids 74 to 144 (71 residues), 61.5 bits, see alignment E=8.5e-21

Best Hits

Swiss-Prot: 85% identical to ASNC_ECO57: Regulatory protein AsnC (asnC) from Escherichia coli O157:H7

KEGG orthology group: K03718, Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA (inferred from 100% identity to rah:Rahaq_4405)

Predicted SEED Role

"Regulatory protein AsnC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>EX31_RS06150 transcriptional regulator AsnC (Rahnella sp. WP5)
MTEIYQLDELDRGILNALMDNARTPYAELAKVFTVSPGTIHVRVEKMKQAGIITGAHITV
NPKQLGYDVCCFIGIILKSAKDYPSALKKLESIEEVVEAYYTTGHYSIFIKIMCRSIDSL
QHVLINKIQTIDEIQSTETLISLQNPITRTIQP