Protein Info for EX31_RS05985 in Rahnella sp. WP5

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 70 bits, see alignment E=3.4e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 461 (456 residues), 617.8 bits, see alignment E=6.3e-190 PF00308: Bac_DnaA" amino acids 129 to 288 (160 residues), 250.4 bits, see alignment E=2.7e-78 PF01695: IstB_IS21" amino acids 164 to 266 (103 residues), 35.2 bits, see alignment E=2.8e-12 PF00004: AAA" amino acids 165 to 266 (102 residues), 27 bits, see alignment E=1.6e-09 PF08299: Bac_DnaA_C" amino acids 372 to 440 (69 residues), 112.4 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 96% identical to DNAA_YERE8: Chromosomal replication initiator protein DnaA (dnaA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to rah:Rahaq_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>EX31_RS05985 chromosomal replication initiator protein DnaA (Rahnella sp. WP5)
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELNDNTLALYAPNRFVLDWVRDKYLNNIN
GLLNDFCGTDAPLLRFEVGSKPVIQRVSQPVAASVSSQAAPAIPRLAPSRPSWDSSPAQP
ELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHA
VGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKE
RSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVA
ILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALR
DLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPE
IGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS