Protein Info for EX31_RS05945 in Rahnella sp. WP5

Annotation: heat shock chaperone IbpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF00011: HSP20" amino acids 36 to 132 (97 residues), 59.6 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 79% identical to IBPB_PECAS: Small heat shock protein IbpB (ibpB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K04081, molecular chaperone IbpB (inferred from 100% identity to rah:Rahaq_0010)

Predicted SEED Role

"16 kDa heat shock protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>EX31_RS05945 heat shock chaperone IbpB (Rahnella sp. WP5)
MRNYDISPLLRQWIGFDKLASSMQGADQAFPPYNIEKSDDNHYRISLALAGFQQSELNIE
VEGPRLTVSGTPAQLETKVEYLHQGLVIKPFTLSFTLAEHMHVSAAEFTNGLLHINLVRD
VPEALQPQKIAIGTEKPALENQSE