Protein Info for EX31_RS05920 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 375 (358 residues), 192.1 bits, see alignment E=1.3e-60 amino acids 268 to 420 (153 residues), 56.6 bits, see alignment E=2.2e-19 PF11700: ATG22" amino acids 164 to 416 (253 residues), 26.8 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to rah:Rahaq_0015)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>EX31_RS05920 MFS transporter (Rahnella sp. WP5)
MSQSRIAARRWWYIMPIVFITYSLAYVDRSNFSFASAAGINDDLGITKGMSSLLGALFFL
GYFFFQIPGTIYAERRSVKKLIFWCLLLWGGFASLTGVVTNIPMLAVIRFALGVVEAAVM
PAMLVYISNWFTKSERSRANTFLILGNPVTVLWMSVLSGYLIKSFGWREMFIFEGIPAVI
WAVIWWFTVKDKPEQVGWLNDQEKQALAAQLEKEQETIQAVGGYREAFRSRNVVLLCLQY
FFWSIGVYGFVLWLPSILRDGKSMGMVEAGWLSSAPYLAATIAMILVSWASDKMQNRKLF
VWPLLLVGALAFFGSWAAGTNNFWLSYSLLVIAAAAMYAPYGPFFAIIPEMLPKNVSGGA
MALINSLGALGSFFGSWFVGYLNGNTGSPAASFIFMAVSLLVSAGLTLLVRPRKANIQPK
EVSLTQGSKS