Protein Info for EX31_RS05785 in Rahnella sp. WP5

Annotation: superoxide dismutase [Mn]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 4 to 91 (88 residues), 114.6 bits, E=2.4e-37
• PF02777: Sod_Fe_C
  • amino acids 98 to 203 (106 residues), 144.4 bits, E=1e-46

Best Hits

Swiss-Prot: 87% identical to SODM_SALTY: Superoxide dismutase [Mn] (sodA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to rah:Rahaq_0042)

MetaCyc: 86% identical to superoxide dismutase (Mn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (208 amino acids)

>EX31_RS05785 superoxide dismutase [Mn] (Rahnella sp. WP5)
MNMSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALESLPELAALPVEELI
TKLDQVPADKKVALRNNAGGHANHSLFWKGLKTGTTLQGELKSAIERDFGSVDAFKETFE
KAATTRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGASGYPLLGLDVWEHAYYLKY
QNKRPDYIKAFWAVVNWDEAAKRLAEAK