Protein Info for EX31_RS05715 in Rahnella sp. WP5

Annotation: benzoate/H(+) symporter BenE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 136 to 165 (30 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 251 to 280 (30 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 5 to 386 (382 residues), 480.9 bits, see alignment E=1.5e-148 PF03594: BenE" amino acids 10 to 384 (375 residues), 474.6 bits, see alignment E=1.1e-146

Best Hits

Swiss-Prot: 57% identical to YDCO_ECOLI: Inner membrane protein YdcO (ydcO) from Escherichia coli (strain K12)

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 99% identity to rah:Rahaq_0057)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>EX31_RS05715 benzoate/H(+) symporter BenE family transporter (Rahnella sp. WP5)
MASRLSLQNLTFSAVIAGFVAVLVGYTSSAAIIFQAAEAAGASVAQIGGWLSMLGLGMGV
TSIGLSLYYRTPVVTAWSTPGAALLVTSLPGTSLNEAIGVFVFATGLILLCGVTGLFARL
MHYIPQALSAAMLGGILLRFGLNAFTSLQSNFALAGTMCLVYLLAKRALPRYAVVMALVA
GLIVAALQGNIALHGQTLTFAAPAFVMPHFTLSSIIGIGIPFFVVTMASQNAPGIATLKA
HGYHLPVSPLISWTALTALVLAPFGGFTICIAAITAAICMGEDIHPDPKKRYMAAVSAGV
FYLIAGVFGGSIGMVFTALPEALIHTIAGLALLGTIAGSLYRALENERQRDAAVITFLIT
ASGVTLLGVGSAFWGLAGGVITHLILSIPARNRDKSAGKS