Protein Info for EX31_RS05625 in Rahnella sp. WP5

Annotation: urea ABC transporter permease subunit UrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 231 to 257 (27 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details amino acids 454 to 480 (27 residues), see Phobius details amino acids 489 to 507 (19 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 228 to 519 (292 residues), 426.8 bits, see alignment E=2.6e-132 PF02653: BPD_transp_2" amino acids 231 to 505 (275 residues), 142.3 bits, see alignment E=1.7e-45

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to rah:Rahaq_0072)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>EX31_RS05625 urea ABC transporter permease subunit UrtB (Rahnella sp. WP5)
MRILIRSLLFLLCCLPLLAEAGAANDFAAASRSQQATLLQQWAADPQPERLPLLEALKQE
NVVIDEAKHAFAQNGDQLTPLEGDVKPQGDTKKVWLNNRLRILIANALSAHRLVSTDSAV
RLQAAKALQREAQADQLPLLTRRLEQEKDSTVHDALSIALANLQLADASPQVRLKAVELL
GTSGDPDTQGRLQSLTDPKTEPDATVRNAALASLKAVQHRLMIGDLLGQAFTGLSLGSIL
LLAALGLAITYGLLGVINMAHGEMLMLGSYSTYMVQSLFQHYAPGLLALYPLVALPVAFF
ITAGIGMALERTVIRHLYGRPLETLLATWGISLILIQGVRMLFGAQNVEVANPGWLSGGI
QLLPNLVLPYNRIAVIIFVLLVLGLTWLLLNKTRLGMNVRAVTQNRAMAACCGVPTGRVD
MLAFGLGSGIAGLGGVALSQLSNVGPELGQGYIIDSFLVVVLGGVGQLAGTVVAAFGLGI
VNKILEPEIGAVLGKILILALIILFIQKRPQGLFAFKGRVID