Protein Info for EX31_RS05570 in Rahnella sp. WP5

Annotation: type II toxin-antitoxin system PrlF family antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF15937: PrlF_antitoxin" amino acids 14 to 112 (99 residues), 114.3 bits, see alignment E=3.2e-37 TIGR01439: transcriptional regulator, AbrB family" amino acids 15 to 53 (39 residues), 32 bits, see alignment E=3.8e-12 PF04014: MazE_antitoxin" amino acids 16 to 54 (39 residues), 29.8 bits, see alignment E=4.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0084)

Predicted SEED Role

"HtaR suppressor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>EX31_RS05570 type II toxin-antitoxin system PrlF family antitoxin (Rahnella sp. WP5)
MSASALWGIKFEAESKVTRRFQTTIPATIRKALNLTENDRIQYKILPDGQVVISRQLEEA
EDPVISAFLGFVAKDMLNNPENMQPVTLSLHEKINVLTAGMAIDLESPLSDDDE