Protein Info for EX31_RS05550 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00005: ABC_tran" amino acids 37 to 182 (146 residues), 118.5 bits, see alignment E=5.3e-38 PF13304: AAA_21" amino acids 148 to 217 (70 residues), 33.7 bits, see alignment E=5.8e-12

Best Hits

Swiss-Prot: 39% identical to AMIF_STRPN: Oligopeptide transport ATP-binding protein AmiF (amiF) from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 95% identity to rah:Rahaq_0087)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>EX31_RS05550 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MTTFMNPTPPLTADRMLETVDLSIAFGKGTHSKTVVDSVTMHIARGESYGLIGESGCGKS
TILRTLTGQNTRYSGAILYQNREQHPVRNKDYYRQVQMVFQDPYASLHPRKMVYHTLLEP
LVIHGMDRREARISDVLNALGLSDAFRYRYPHQLSGGQRQRVALARALIIEPQVLLLDEP
TSALDVSVQAEILNLLKKLRRERNLTYLMVTHDLAVVAHLCDRVAIMHQGKLLEELTAAE
IRSGAAREPYTQQFLAASRH