Protein Info for EX31_RS05540 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details PF12911: OppC_N" amino acids 41 to 86 (46 residues), 58.3 bits, see alignment 5.6e-20 PF00528: BPD_transp_1" amino acids 128 to 309 (182 residues), 103.8 bits, see alignment E=9.9e-34

Best Hits

Swiss-Prot: 46% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to rah:Rahaq_0089)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>EX31_RS05540 ABC transporter permease (Rahnella sp. WP5)
MTDSAKPHLTSRPAFSLRAWLDAPVPATPWQARVQQSLNQWRRFRRNTSALFGLIVILFI
VTVAIFAPWLATHDIYAQNLQLRLAPVSREYWLGTDELGRDIYSRLIYGARITLYITGLT
ALIVGPLGLLVGTLAGTVGGWTDTILMRIVDIFLAFPSLILALGFVAALGPGIENAIIAI
SLSAWPPIARLARAEALSIRKMDYVAAVRLQGASQMRIILRHIIPMCLPSVVVRLTLNMA
GIILTASGLGFLGLGAQAPSPEWGAMLSSGRQFMMTHWTIAAIPGLSILFTSLAFNLFGD
GLRDVLDLRHD