Protein Info for EX31_RS05445 in Rahnella sp. WP5

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 350 to 375 (26 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 403.2 bits, see alignment E=6.3e-125

Best Hits

Swiss-Prot: 89% identical to DCTA_YERE8: C4-dicarboxylate transport protein (dctA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to rah:Rahaq_0110)

MetaCyc: 88% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>EX31_RS05445 dicarboxylate/amino acid:cation symporter (Rahnella sp. WP5)
MKKSLFRSLYFQVLLAITVGVLLGHFYPEIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG
IAGMESMKAVGRTGAIALLYFEIVSTLALIIGLVIVNIVQPGAGMNVDPAALDAKAVAVY
AEQAQSQGIIPFLLDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGHKGQLIFNVIES
FSQVIFGIINMIMRLAPVGAFGAMAFTIGKYGVGSLVQLGQLILCFYLTCILFVVVVLGL
IARFTGFSIFKFVNYIKEELLIVLGTSSSESALPRMLDKMERLGCKKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNTHMDIWHQITLIVVLLLSSKGAAGVTGSGFIVLAATLSA
VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCDQLDEGQLKATLNGQKGL
TEAEKSA