Protein Info for EX31_RS05020 in Rahnella sp. WP5

Annotation: glycogen debranching protein GlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 TIGR02100: glycogen debranching enzyme GlgX" amino acids 7 to 665 (659 residues), 898.3 bits, see alignment E=1.4e-274 PF02922: CBM_48" amino acids 11 to 96 (86 residues), 70.7 bits, see alignment E=1.6e-23 PF00128: Alpha-amylase" amino acids 185 to 271 (87 residues), 34 bits, see alignment E=3.7e-12 PF18390: GlgX_C" amino acids 573 to 664 (92 residues), 80.5 bits, see alignment E=9.8e-27

Best Hits

Swiss-Prot: 64% identical to GLGX_SERP5: Glycogen debranching enzyme (glgX) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 99% identity to rah:Rahaq_0203)

MetaCyc: 60% identical to limit dextrin alpha-1,6-glucohydrolase (Escherichia coli K-12 substr. MG1655)
RXN0-5146 [EC: 3.2.1.196]

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 3.2.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>EX31_RS05020 glycogen debranching protein GlgX (Rahnella sp. WP5)
MKQLATGQPAPFGAHLRDNGVNFCLYSAHAEKVELCLFDETGSEQHLPLTGRTGHLWHGF
VPGLKAGQRYGYRVYGPFDPKKGHRFNPKKVLIDPSARAIDGVLLDNARFTGGTDAPDDK
DSAVVAPKSVVVAGNFDWGDDQPPAKPWGETVIYEAHVRGLTRQHPHIPAALRGTYAGLA
HPVMLEYLQHLGVTAIELLPVQHHADEPRLQHLGLSNYWGYNVLAPCAVEPRYASGLGGV
SALNEFKSAVKALHQAGIEVILDVVFNHSAELDIDGPFISFRGIDNASGYWLNDDGSDNN
MTGCGNTIRLMDEDMIAWTLDCLHYWVRECHVDGFRFDLATVLGRTPEFTAQSPLFLAIK
HDDILSKIKLIAEPWDIGAGGYQLGNFPAPFAEWSDVWRDDMRQFWLHGDLSLGQFAGRF
AASADKFNPAQREPYASINMLTAHDGFTLRDLVSFNQKHNQANGEENRDGHNENFSQNHG
EEGLEASEGVLQQRRLSQRALLATLCLSQGTPMLLAGDELGNSQSGNNNAYCQDNPLTWL
DWENADESLTAYTCALIALRRKIPALTQNRWWQEGSDDVQWLNQQGQPMSPGDWEQGPQQ
WLQICLSQRWLVIVNASLHEVDLHLPPGNWQPVAPFNSVLFDEEPRRVMEGSQWRAAAKT
LCVLQDFTSQSRSL