Protein Info for EX31_RS04950 in Rahnella sp. WP5

Annotation: 3-keto-L-gulonate-6-phosphate decarboxylase UlaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to ULAD_ECOSE: 3-keto-L-gulonate-6-phosphate decarboxylase UlaD (ulaD) from Escherichia coli (strain SE11)

KEGG orthology group: K03078, 3-dehydro-L-gulonate-6-phosphate decarboxylase [EC: 4.1.1.85] (inferred from 100% identity to rah:Rahaq_0219)

MetaCyc: 89% identical to 3-keto-L-gulonate-6-phosphate decarboxylase UlaD (Escherichia coli K-12 substr. MG1655)
3-dehydro-L-gulonate-6-phosphate decarboxylase. [EC: 4.1.1.85]

Predicted SEED Role

"3-keto-L-gulonate-6-phosphate decarboxylase UlaD (EC 4.1.1.85) (L-ascorbate utilization protein D)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 4.1.1.85)

MetaCyc Pathways

L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
L-ascorbate degradation II (bacterial, aerobic) (6/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>EX31_RS04950 3-keto-L-gulonate-6-phosphate decarboxylase UlaD (Rahnella sp. WP5)
MSHSLPMLQVALDNQSMDDAYKTTRLIASEVDIIEVGTILCVAEGVRAVRDLKALYPEKI
VLADAKIADAGKILSRMCFEAHADWVTVICCADINTTKGALEVAKEFNGDVQIELTGYWT
WEQAQEWHDAGIGQVVYHRSRDAQAAGVAWSDADISAIKRLSAMGFKVTITGGLALEDLP
LFKDIPVHVFIAGRSIRDAKDPVDAARQFKKSIRQLWG