Protein Info for EX31_RS04880 in Rahnella sp. WP5

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 313 (309 residues), 239.1 bits, see alignment E=2.7e-75

Best Hits

KEGG orthology group: K13936, malonate transporter (inferred from 100% identity to rah:Rahaq_0234)

Predicted SEED Role

"FIG00613710: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>EX31_RS04880 AEC family transporter (Rahnella sp. WP5)
MTYVILHALAPIFVIMILGFYAGKAKMVDNQNVSLLNIFVMDFALPAALFAATVQTPWAG
IVEQSPLILVLVLAMWITYAAIYFICTKVFKKSAQDAAVLTLTVALPNYAALGLPILGSV
LGDAPSTSLSVAVSIACGSVLMTPFCLLILEREKARLSGENQGSSLALLPVLMWRSVKKP
IVWAPLLGVILSAIGIKMPEIFLASIKPLGLSATASALFLTGVILSARKLKINGPVLLSC
VAKNLIQPFIAWGLVLAFGLSGQVAVTAILMIALSAGFFGIVFGNRFGVQSPDAEASLLI
SSVLCIVTLPLFISLTAALH