Protein Info for EX31_RS04875 in Rahnella sp. WP5

Annotation: malonate decarboxylase holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase" amino acids 5 to 201 (197 residues), 147.1 bits, see alignment E=3.1e-47 PF20866: MdcG_N" amino acids 5 to 78 (74 residues), 65 bits, see alignment E=5.3e-22 PF10620: MdcG" amino acids 95 to 202 (108 residues), 106.7 bits, see alignment E=7.8e-35

Best Hits

Swiss-Prot: 52% identical to MDCG_KLEP7: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 96% identity to rah:Rahaq_0235)

MetaCyc: 52% identical to phosphoribosyl-dephospho-CoA transferase (Klebsiella pneumoniae)
Malonate decarboxylase holo-[acyl-carrier-protein] synthase. [EC: 2.7.7.66]

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>EX31_RS04875 malonate decarboxylase holo-ACP synthase (Rahnella sp. WP5)
MCDPRAHDFVWISDSSALQSDTTLPEWVNTGWRTALPLVVRRDKRADGAVPVGIRGLTRI
QRAAAWIDPAAVERVVTPESLVSDVNALLHLPFVSQQPVQALITLCSLKLPFAWGVTGSC
AYALASDLPVMHADSDLDLLVRCDTPAEPSQFSDFYNQLQRLPCRADVQINTPQGGFALS
EWLRGGDIMLKTASGPLLVRDPWQLPGD