Protein Info for EX31_RS04625 in Rahnella sp. WP5

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 417 to 434 (18 residues), see Phobius details amino acids 439 to 456 (18 residues), see Phobius details amino acids 462 to 483 (22 residues), see Phobius details amino acids 486 to 487 (2 residues), see Phobius details amino acids 490 to 508 (19 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 14 to 674 (661 residues), 626 bits, see alignment E=3.8e-192 PF12805: FUSC-like" amino acids 65 to 334 (270 residues), 196.6 bits, see alignment E=4.8e-62 PF13515: FUSC_2" amino acids 382 to 501 (120 residues), 78.7 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 66% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0286)

Predicted SEED Role

"FIG01219693: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>EX31_RS04625 membrane protein (Rahnella sp. WP5)
MTLWRRLFYHPEVNYALRQTLVLCLPVGICWLFGNLQMGLLFSLCPACCNIAGLDTPHKR
FFKRLLVGGSLFAVSSLLLQLMLESWHIPLPLIMLSLALLLGVTGEISPLHARLLPGALV
ATIFTLSMVGVRPMWQAPVLFAAGTAWYGLFNWAWFRISEEQPMRETLSQLYLQLADYFE
AKYSLLTQHTDPETALPPLLTRQQQVIDLIALLYQQLHMLPQHGHHHHHKRLFQRFQVAL
DLQEHITVSLHQPEEVQKLVEESHAEAVIRRNAQVISTRLRVIADDILYHRLSGRFTMAN
ELTALEKIAARNPDNPVGQFCYYHFSRIARLLRTQRPLYKRDLMNTQPRLPFWPALKSYL
SFKSVALRNAARLGIILAIGSSLGLFFNLPKPYWILLTIMLVSQNGYNATRVRIQHRALG
TLAGLLIASGLLKLELPEGTTLLCMLLITLLSYTVLRKNYGLAMVGMTVTAVYTLQLLAM
NGVHFLVPRLVDTLIGCALAFGGTIWLWPQWQSGLLRQNAHQALEIYQDAIRLLLEESPD
TAKLAYTRMQVNQAHNKLFTSLNQAMQEPGFNSHYLADMRLWVTHSQFVVEHINAMTILA
REHYMLPEKLATEYLQTCEIALQSCQQRLLYDGPGSENNLFNAPELHPDMPLTEMERHLR
RVISHLSVMHTISSLAWKQRPHHGIWLTRRA