Protein Info for EX31_RS04255 in Rahnella sp. WP5

Annotation: DUF3578 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 PF12102: MrcB_N" amino acids 17 to 100 (84 residues), 35.2 bits, see alignment E=1.5e-12 PF00004: AAA" amino acids 190 to 367 (178 residues), 26.1 bits, see alignment E=1.6e-09 PF07728: AAA_5" amino acids 224 to 367 (144 residues), 49.4 bits, see alignment E=7.3e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3859)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (523 amino acids)

>EX31_RS04255 DUF3578 domain-containing protein (Rahnella sp. WP5)
MSTDFENLLKETGFADEVRRFIKQAQTDELKTKGLYSDKVCSYKLKVSFGQGNIAQVPWI
AFLGEGQEVSDGIYPVFLYYKTDDHLVLSYGISETKPPKNKWQNSILQNKTVSLHMQEKG
FPFKRYGSSYVATVYENASKIVNSPSFDTILYHDLGKVLQDYQVILESEGAVESTPITTV
SEDNIMLNQILYGPPGTGKTYATVNTALSILDKDYYETNQFNRTVLKKRFEKLCEDGFIN
FVTFHQSFSYEDFVEGLRPSIGVSKQLEYHVEPGIFKKICTNAMTSPSKRFVLIIDEINR
GNVSRIFGELITLIETSKRKGEDEELVTKLPYSKETFSVPNNVYIIGTMNTADRSLSGLD
VALRRRFIFRETPPQPELLADIRIEGLNVGEMLAVINNRIEILLNADHCLGHAYFLPLKK
NPTLEQLSSIFKDQVIPLLQEYFFEDWQKIRWILNDHRKNDDICFISPTQWDQSLFGSEV
TEPLKGNTYKVNDNNFSKIEAYLGIIDTRLISALEKIADEKNV