Protein Info for EX31_RS04220 in Rahnella sp. WP5

Annotation: HAAAP family serine/threonine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details TIGR00814: serine transporter" amino acids 17 to 416 (400 residues), 587.9 bits, see alignment E=5.2e-181 PF03222: Trp_Tyr_perm" amino acids 29 to 328 (300 residues), 46.4 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 80% identical to SDAC_ECOLI: Serine transporter (sdaC) from Escherichia coli (strain K12)

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to rah:Rahaq_3852)

MetaCyc: 80% identical to L-serine:H+ symporter SdaC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>EX31_RS04220 HAAAP family serine/threonine permease (Rahnella sp. WP5)
MDNTTIGTLSEKSISSWRKTDTMWMLGLYGTAIGAGVLFLPINAGIGGLIPLIIMAILAF
PMTFFAHRGLTRFVLSGKNAGEDITEVVEEHFGITAGKLITLLYFFAIYPILLVYSVAIT
NTVESFITHQMHMNAPPRALLSLILILGLMTLVHFGQDMIVKAMSILVFPFVTVLMALAL
YLIPNWNMSVFTNASLSGNGVGHGMLMTLWLVIPVMVFSFNHSPIISSFAVAKRKEYGDG
AEKKCSRILAFSHIMMVITVMFFVFSCVLSLSPADLMEAKSQNVSILSYLANHFSNPVIE
YIAPFIAFIAITKSFLGHYLGAREGFNGMVIKSLRSKGKKIALPTLNRYTGIFMLLTTWL
VATLNPSILGMIETLGGPIIAMLLFLMPMYAIRKVPAMKKYSGHISNVFVAVMGLIAMSA
IVFSLMG