Protein Info for EX31_RS04215 in Rahnella sp. WP5

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 2 to 451 (450 residues), 709 bits, E=1.3e-217
• PF03315: SDH_beta
  • amino acids 3 to 154 (152 residues), 192.7 bits, E=5.2e-61
• PF03313: SDH_alpha
  • amino acids 184 to 448 (265 residues), 297.2 bits, E=1.3e-92

Best Hits

Swiss-Prot: 74% identical to SDHM_ECOLI: L-serine dehydratase 2 (sdaB) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to rah:Rahaq_3851)

MetaCyc: 74% identical to L-serine deaminase II (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Protein Sequence (455 amino acids)

>EX31_RS04215 L-serine ammonia-lyase (Rahnella sp. WP5)
MISVFDIFKIGIGPSSSHTVGPMKAGKIFTDELISSGHITQTTRVAVDVYGSLSLTGKGH
HTDLAIIMGLAGNMPDDVDIDAIPAFIREVENTGRLMLGKGAKEVDFPASSGMNFHSGNL
PLHENGMTISAFSGDELLYTQTYYSIGGGFIVEASKFGMQDENPVVRPYPFRSASDLQKH
CTDTGLSLSALMLQNELAGHTRTEISDHFAAIWNVMSEGITRGIHTEGLLPGPMKINRRA
AALRRILVTQDKNNVDPMGVVDWINMYAMAVNEENAAGGRVVTAPTNGACGIIPAVLTYY
DQFIRPISPDSYSRFFLASGAVGILFKMNASISGAEVGCQGEVGVACSMAAAGLTELLGG
STAQVFMAAEIAMEHHLGLTCDPLAGQVQVPCIERNAISAVKAVNASRMALRRTSEPRVC
LDKVIETMYETGKDMNSKYRETSTGGLAIKVLACN