Protein Info for EX31_RS04190 in Rahnella sp. WP5

Annotation: lactaldehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR02638: lactaldehyde reductase" amino acids 2 to 378 (377 residues), 560 bits, see alignment E=1.1e-172 PF00465: Fe-ADH" amino acids 8 to 176 (169 residues), 154.8 bits, see alignment E=2.5e-49 PF13685: Fe-ADH_2" amino acids 14 to 106 (93 residues), 29.2 bits, see alignment E=1.3e-10 PF25137: ADH_Fe_C" amino acids 187 to 382 (196 residues), 227.1 bits, see alignment E=2.4e-71

Best Hits

Swiss-Prot: 46% identical to ADH2_ECOLI: Probable alcohol dehydrogenase (yiaY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3846)

MetaCyc: 76% identical to L-lactaldehyde reductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lactaldehyde reductase. [EC: 1.1.1.77]

Predicted SEED Role

"Lactaldehyde dehydrogenase involved in fucose or rhamnose utilization (EC 1.2.1.22)" in subsystem L-fucose utilization or L-rhamnose utilization (EC 1.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.22

Use Curated BLAST to search for 1.1.1.77 or 1.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>EX31_RS04190 lactaldehyde reductase (Rahnella sp. WP5)
MSFMLALPKISLHGQGAIEDMVAMLATKQHGKALIVTDGQLIELGLLDSLFSALKQAGLP
YAIYGGVVPNPTSAHVDEGFRLYQENQCDYLIAFGGGSPIDTAKGIKILTANPGPATMYS
GVGKVTKPGVFLVAINTTAGTAAELTSNAVIIDSQRQVKEVIIDANLIPDIAVDDPAVML
KIPASVTAATGMDALTHAIEAYVSVGAHPLTDPTALAAISTITQWLPKAVDHGDDIEARE
KMAQGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPVVEEFNRASAPHRFA
DIARAMGVHTQGISETQASIAAIDAIRKLSTRVGIPSGFKELGINESDIEGWLDKALADP
CAPCNPRTATREEVRELYLKAM