Protein Info for EX31_RS04155 in Rahnella sp. WP5

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 189 to 347 (159 residues), 150.9 bits, see alignment E=1.3e-48 PF00990: GGDEF" amino acids 191 to 344 (154 residues), 151.2 bits, see alignment E=1.1e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3839)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>EX31_RS04155 GGDEF domain-containing protein (Rahnella sp. WP5)
MISHSYDELLKSKHRLAMLLFFFLNSATALFSMAYPPENAVSTPFPLVLIFVLCFSGLIF
SFFSKKNYSAHLNMCSVAVGLLWAWQITLRFEEIGHLDKNYLLVSLLSIFFISAIALSDN
FLAFCLHAVPSTLCVIFLDDFQHVERILFTVSLPLIGLWLHHLMLKRSDEFTRRMVSNLY
SEREKFSDLSMLDPLTGLYNRRGLQNKLETLFNQASGHYVMLLDIDHFKAYNDNYGHTMG
DQALVRVSAAIRDAVRSRDVVVRYGGEEFLVLMSNVKQEHAVRMAERIQNKVLGLNIPHL
FNVEVSTHVTVSAGLAALEDGDFIKALGKADASLYNAKNSGRNKIFYAWEEPQEIQQAVE
EKIA