Protein Info for EX31_RS03820 in Rahnella sp. WP5

Annotation: glutathione-regulated potassium-efflux system oxidoreductase KefF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF02525: Flavodoxin_2" amino acids 2 to 166 (165 residues), 146.4 bits, see alignment E=9.1e-47 PF03358: FMN_red" amino acids 42 to 114 (73 residues), 25.4 bits, see alignment E=9.5e-10

Best Hits

Swiss-Prot: 71% identical to KEFF_SHIF8: Glutathione-regulated potassium-efflux system ancillary protein KefF (kefF) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K11746, glutathione-regulated potassium-efflux system ancillary protein KefF (inferred from 100% identity to rah:Rahaq_3774)

MetaCyc: 70% identical to regulator of KefC-mediated potassium transport and quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefF" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>EX31_RS03820 glutathione-regulated potassium-efflux system oxidoreductase KefF (Rahnella sp. WP5)
MILIIYAHPYPRHSRANQGLLSAVSDLPNVEVRSLYDLYPDFNIDIAAEQKAVERADLVV
FQHPIQWYSLPPLMKLWIDKVLEHGWAYGHEGNALNGKHCLWAVTTGGNEHHFELGDHPD
FDVLAQPLQATAIYCGMHWLPYFAVHNTFICDEVALKAAGEEYRRRLTACLSLKEGCPPE
VSLG