Protein Info for EX31_RS03810 in Rahnella sp. WP5

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 64 (27 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 203 (189 residues), 126.6 bits, see alignment E=4.3e-41

Best Hits

Swiss-Prot: 33% identical to YRHP_BACSU: Uncharacterized membrane protein YrhP (yrhP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3772)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>EX31_RS03810 LysE family translocator (Rahnella sp. WP5)
MLETTLFVASIAFLGMLSPGPDFFLVIKNAARYPRIAALMTSLGVICGVITHMSYCVAGL
AVVITTTPWLFDLLKYVGAAYLIWVGIQALFSRSNSKMNLDGLEPQQVKLRTAFVQGYLC
NLLNPKATLFFLAMFTQVLQINSTFGEKLWYASIIVGLSAIWWPSLALLIQSPPVRRGLA
KAQKLIDKLLGGVLIGLGIKVALS