Protein Info for EX31_RS03655 in Rahnella sp. WP5

Annotation: catabolite repressor/activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 328 (327 residues), 484.9 bits, see alignment E=6.1e-150 PF00356: LacI" amino acids 3 to 50 (48 residues), 65.2 bits, see alignment 7.5e-22 PF00532: Peripla_BP_1" amino acids 62 to 304 (243 residues), 61 bits, see alignment E=2.7e-20 PF13407: Peripla_BP_4" amino acids 64 to 301 (238 residues), 38.5 bits, see alignment E=2e-13 PF13377: Peripla_BP_3" amino acids 183 to 319 (137 residues), 41.3 bits, see alignment E=3.5e-14

Best Hits

Swiss-Prot: 87% identical to CRA_ECO57: Catabolite repressor/activator (cra) from Escherichia coli O157:H7

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 100% identity to rah:Rahaq_3741)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>EX31_RS03655 catabolite repressor/activator (Rahnella sp. WP5)
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVKEHNYHPNAVAAGLRAGR
TRSIGLVIPDLENTSYTKIANFLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDA
IIISTSLPPEHPFYQRWANDDFPIIALDRALDPEHFISVVGADQDDALMLAQELRTFPAE
SVLYLGALPELSVSFLREQGFRQAWAEDPRQPEYLYANAYDRESAAIVFAEWLKTHPMPQ
ALFTTSFQLLQGVMDVTLKMEGRLPVNLAIATFGDNELLDFLECPVLAVAQRHRDVAERV
LELVLACLDEPKKPKAGLTRIRRNLFRRGRLSRK