Protein Info for EX31_RS03440 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 199 to 226 (28 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 272 (186 residues), 51.9 bits, see alignment E=4.1e-18

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to rah:Rahaq_3698)

Predicted SEED Role

"Putative ABC transporter of substrate X, permease subunit I" in subsystem ABC transporter of unknown substrate X

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>EX31_RS03440 ABC transporter permease (Rahnella sp. WP5)
MKWRNELTAWLLMISGLGTIVLLMGSTFYVVLVQSIGYFNLSGDSQFSLEYWQNVLQDPV
LHSALIYSVKVSILGAFGAVLLSYPLALWLRQPLVAKEGIVAVLRAPMFIPGLVAAFLFI
NIIAYHGVINELLLALGVIDQPLRMQNDDFGWGVVILQIWKNLPFALILVGGSVNAIRTD
VLDAASNLGASRWRCFRDVIFPLTLPAVQVSLILIFIGALGDFAFFSVAGPRNTYSLARL
MQATAMEYGEWNNSAVIAVIIMLTAALGTLLIAILLTPLATRKGEVK