Protein Info for EX31_RS03435 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 9 to 38 (30 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 141 to 157 (17 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 262 (168 residues), 50.7 bits, see alignment E=9.1e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to rah:Rahaq_3697)

Predicted SEED Role

"Putative ABC transporter of substrate X, permease subunit II" in subsystem ABC transporter of unknown substrate X

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>EX31_RS03435 ABC transporter permease (Rahnella sp. WP5)
MNRTANGRLIVTISLLFFILVNLVWLGLPFSMAILWSLVDPQHPWSYPDLFPQVLSINRW
IQVWQQTSLSEALFNSYTIAPAVAMLSLLLSLPTAYAFGRMTFRGKAVAEMLTLIPLVMP
GMIIGIFFSAMLMNLNISNPFISIVLGHTVLTLPYSIRIMSAGFKAVPQDLIDASRDLGA
SHWGTFCNAFLPMLKPSFLAALIFCLVRSLEEFSISYVLGAPDFITVPTILYSFLGYSFV
RPDAAVVSMILVIPNVVLMVIIEKLLKGNYLSQSTGKA