Protein Info for EX31_RS03375 in Rahnella sp. WP5

Annotation: polyamine aminopropyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17284: Spermine_synt_N
  • amino acids 10 to 61 (52 residues), 61.4 bits, 9.2e-21
• TIGR00417: spermidine synthase
  • amino acids 11 to 282 (272 residues), 391.2 bits, E=1.1e-121
• PF01564: Spermine_synth
  • amino acids 64 to 245 (182 residues), 240.4 bits, E=1.7e-75

Best Hits

Swiss-Prot: 85% identical to SPEE_SERP5: Polyamine aminopropyltransferase (speE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to rah:Rahaq_3687)

MetaCyc: 81% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• aminopropylcadaverine biosynthesis (3/3 steps found)
• spermidine biosynthesis I (2/2 steps found)
• superpathway of polyamine biosynthesis I (6/8 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Protein Sequence (291 amino acids)

>EX31_RS03375 polyamine aminopropyltransferase (Rahnella sp. WP5)
MSRNSSSKEIWYETLHAHFGQYFSVDKELYREKTDHQDLVIFENAALGRVMALDGVVQTT
ERDEFIYHEMLTHVPLFAHGSARKVLIIGGGDGAMLREVSRHKGVESITMVEIDAGVVEF
CRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTTETFDVIISDCTDPIGPGESLFTSAFYE
GCARCLNPGGIFVAQNGVCFLQQDEAVNSHTKLSHYFSDVSFYQAAIPTYYGGIMTFAWA
TNSPEYRQIDSKTLQARFDAADITCRYYNPAIHHGSFALPQYLLNALSAAR