Protein Info for EX31_RS03205 in Rahnella sp. WP5

Annotation: glutamate-1-semialdehyde 2,1-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 3 to 425 (423 residues), 662.1 bits, see alignment E=1.5e-203 PF00202: Aminotran_3" amino acids 32 to 395 (364 residues), 255.7 bits, see alignment E=3.3e-80

Best Hits

Swiss-Prot: 88% identical to GSA_YERE8: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 100% identity to rah:Rahaq_3653)

MetaCyc: 87% identical to glutamate-1-semialdehyde 2,1-aminomutase subunit (Salmonella enterica enterica serovar Typhimurium)
Glutamate-1-semialdehyde 2,1-aminomutase. [EC: 5.4.3.8]

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>EX31_RS03205 glutamate-1-semialdehyde 2,1-aminomutase (Rahnella sp. WP5)
MSKSESLFTQAQALIPGGVNSPVRAFSGVGGVPLFIARADGAFLFDADGKAYIDYVGSWG
PMVLGHNNAEIRNAVIEAAERGLSFGAPTEMEVKMAELVTGLVPSMDMVRMVNSGTEATM
SAIRLARGFTHRDKIVKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLDSVRAAFEQFPDDIACIIVEPVAGNMNCVPPLPEFLPGLRAICDEFGALLIIDEVM
TGFRVALGGAQEYYDVMPDLTCLGKIIGGGMPVGAFGGRRDVMEALAPTGPVYQAGTLSG
NPIAMAAGIACLTQVAQPGVHQTLTERTTQLAEGLLDAAQKENIPFVVNHVGGMFGLFFT
DAETVTCYQDVMKYDVERFKKFFHLMLEEGVYLAPSAFEAGFMSLAHTPEDIQRTIDAAR
RCFAKL