Protein Info for EX31_RS03185 in Rahnella sp. WP5

Annotation: vitamin B12 ABC transporter substrate-binding protein BtuF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 26 to 227 (202 residues), 88.6 bits, E=2.2e-29

Best Hits

Swiss-Prot: 62% identical to BTUF_YERPE: Vitamin B12-binding protein (btuF) from Yersinia pestis

KEGG orthology group: K06858, vitamin B12 transport system substrate-binding protein (inferred from 99% identity to rah:Rahaq_3649)

MetaCyc: 57% identical to vitamin B12 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Protein Sequence (270 amino acids)

>EX31_RS03185 vitamin B12 ABC transporter substrate-binding protein BtuF (Rahnella sp. WP5)
MMRRFGLILSCLLLPVAATAAPAQRVISLAPNLTELAFAAGLGDRVIGVSAYSDYPPQAS
KLEQVANWQGINVERIVTLKPDVVLAWRGGNPQRPLDQLISLGIHVIYLDPQNAEQVAQA
LEQLAVYSPSPESAKRAAADFRQQWQALKLKYHRQKPVSAFIQFGTQPLFTAAATTMQSE
VLNVCGAKNIFADSRVPWPQVSREQVLSRHPQVIVISGGKSQKQVIEDYWRSMLSAQVIA
LDPDWFSRAGPRILLAAQQLCPQLAALPER