Protein Info for EX31_RS03170 in Rahnella sp. WP5

Annotation: serine endoprotease DegP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 42 to 480 (439 residues), 546.4 bits, see alignment E=2.6e-168 PF13365: Trypsin_2" amino acids 120 to 256 (137 residues), 117.1 bits, see alignment E=2.9e-37 PF00089: Trypsin" amino acids 120 to 281 (162 residues), 81.5 bits, see alignment E=2e-26 PF00595: PDZ" amino acids 291 to 373 (83 residues), 56.3 bits, see alignment E=8.7e-19 amino acids 398 to 471 (74 residues), 47.8 bits, see alignment E=4e-16 PF13180: PDZ_2" amino acids 311 to 385 (75 residues), 51 bits, see alignment E=3.7e-17 PF17820: PDZ_6" amino acids 321 to 357 (37 residues), 40 bits, see alignment 7.2e-14 amino acids 422 to 473 (52 residues), 38.5 bits, see alignment 2.1e-13

Best Hits

Swiss-Prot: 76% identical to DEGP_SALTY: Periplasmic serine endoprotease DegP (degP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04771, serine protease Do [EC: 3.4.21.107] (inferred from 100% identity to rah:Rahaq_3646)

MetaCyc: 75% identical to periplasmic serine endoprotease DegP (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>EX31_RS03170 serine endoprotease DegP (Rahnella sp. WP5)
MKKSSLFLSALALSIGMAMAPVSSALAAETASSSTSTTQLPSLAPMLEKVMPSVVSVNVE
GSAPVKTPRMGQQFQQFFGQNSPLCQDGSPFQGSPVCQGGGQGSDGQPAPEQKEDFRALG
SGVIIDADKGYVVTNNHVVDNATKISVQLNDGRKFDAKVIGKDPRSDIAVIQLQNAKNLT
AIKMADSEQLRVGDYTVAIGNPYGLGETVTSGIVSALGRSGLNIENYENFIQTDAAINRG
NSGGALVNLNGELIGLNTAILAPDGGNIGIGFAIPSNMVKNLSKQMIEFGQVKRGELGIM
GTELNSELAKAMKVDAQRGAFISQVMPKSAAEKAGIKAGDVILSMNGKPISSFASFRADI
GTLPIGTKVTLGLLREGKPMNIDVTIEQSTQTSKIESGNIYTGIEGAELSNGAAGDQKGV
KVDEVKPGSTAARIGLKKGDVILGVNQQKVTNLGELRKILDTKPNVLALDIQRGDTSIYL
LAQ