Protein Info for EX31_RS03130 in Rahnella sp. WP5

Annotation: spore coat U domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05229: SCPU" amino acids 24 to 163 (140 residues), 69.4 bits, see alignment E=2e-23 amino acids 189 to 319 (131 residues), 78.5 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3638)

Predicted SEED Role

"Sigma-fimbriae tip adhesin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>EX31_RS03130 spore coat U domain-containing protein (Rahnella sp. WP5)
MRIFRQQMHRGLLLMLLLGTTWWAKAGCTTAPGSITLGTQNSFAVSSSPLITSGGSGLSC
TGGLLNIAGTNTITAFIGVTQHPSNSQPRLYSGTTGQYLPYSLCKDASCSAVYNQGDTIS
WSSTTALGLLGLFSGPNSTLPLYVRPVAISNLAAGTYTDVIPISWTWNMCSVAIGTLLCL
ADSGNVSGNVALTLNVTNFCYIDSAPNVGFGSAALPSGLTTVVANTISVRCTLNASYSVN
LTSSVPVSGQYRQMASTVGGTTRYLQYQIFKGDSTVWTASTDSSATGTGTSQSFPYTASV
NLAQSNQPAGNYSDMVTVTVTY