Protein Info for EX31_RS03100 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 471 to 493 (23 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 404 (389 residues), 141.4 bits, see alignment E=1.7e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3632)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>EX31_RS03100 MFS transporter (Rahnella sp. WP5)
MTSSSSGSLQVLFTVCLAAVILPLNFVSGAVATPAIARELGGSAQALSWITNSFMLTFGC
FLMAAGALADELGRKKVFVSGVSLFALLSLLQAFSSSLLWIDLLRAAQGIAAAGALAGGA
AALAQEFDGAARTRAFSLMGSSFGVGLAFGPFLAGVLIANFGWRSVFFSATVIAVLSLIT
GAGKMRETRNPQATGIDWPGTLSFTAMLALLTWALMEIPQSGLHSTRVLSLLGGAALLLA
VFVVVELRVKNPMLDLSLFRYIRFIGVQALPLATGFCFVVLLVVLPMLFIGVSGLSEERA
GLMMMALSVPMLIVPLLAAWLTRWISAGVLCTSGLVIAAAGLGWLSQAVLAQDVTGMIAP
MVVVGIGTGLPWGLMDGLSVSVVPKERAGMATGIFSTTRVAGEGISLAIVGAILSMLTHN
ALAARFTGDAISPEAISQAAQRLATGNLTVAQQLITQASTAQLQQLYAVSLHPLLLCLMA
ITLFSALLVLLALRGKHQ