Protein Info for EX31_RS03035 in Rahnella sp. WP5

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 63 (27 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details PF01810: LysE" amino acids 13 to 204 (192 residues), 98.4 bits, see alignment E=1.9e-32

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to rah:Rahaq_3619)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>EX31_RS03035 LysE family transporter (Rahnella sp. WP5)
MMPFSNGFLLSLSLCLDIGIANIAMMTLAMQRGYFHGFWLGIGTCIGDLIYAVLALAGMT
ILLQYQSVRWVLWVGGSLMLMWFTYKMIRAALAPAEDLSAGDGAQPRSVIRNFGRGIVLA
MSSPTAILWFAAVGGALISRMGQGSTANASWFLGGFFIAGVFWTMVICSVGSLGGKMLGT
KMLKYSYVASAAIFSYFALYVVISGYREFILV