Protein Info for EX31_RS02990 in Rahnella sp. WP5

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 307 (302 residues), 49.1 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3610)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX31_RS02990 acyltransferase family protein (Rahnella sp. WP5)
MNTTGLNIIKTLGCLTAVTFFTVYNTYDNYNYNYDTILAFLTFISTIATPLFFVVTGYMD
AGSQHTAEWQLKKIRSILTLFIFWFSIYYLWEPYQKGYLIQPWFIFTLVIIYTFHPLVEW
LAKRRVILAALVASLLIFSFAYDLLAIYFTDHKSFSTPAQFRIWTWVLYYLTGQLLYDPV
VSALYGRPRVAKIAAIAIPFVYIFTWYYEKHFFFSIFNLERNSFILTGSQVYILVVLIII
AANGVKQDATRLPVSEMVSSLGKTMTGVYILHYTFFNLLIQWIPINSLTAKLFVILLTFL
LSVLSSMLLLKNSVTKKLITF