Protein Info for EX31_RS02845 in Rahnella sp. WP5

Annotation: UPF0104 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 21 to 295 (275 residues), 52 bits, see alignment E=3.8e-18

Best Hits

Swiss-Prot: 84% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 98% identity to rah:Rahaq_3577)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>EX31_RS02845 UPF0104 family protein (Rahnella sp. WP5)
MSASHPKWRLAKKILTWFFFIAVAMLLVVYARTVNWEDVWKVIRNYNRTPLLISVVLVII
SYLLYGCYDLLARAYCGHKLAARQVMLVSFICYAFNLTLSTWVGGIGMRYRLYSRLGLPG
ATITRIFSLSITTNWLGYILLGGIIFTFGVVELPSHWYIDEGTLRIVGIVLLAMVATYVW
FCAYAKRRHMTVKGQKLVLPSFKFALAQMVISSANWMAMGAIIWLLLGEDVNYFFVLGVL
LVSSIAGVIVHIPAGIGVLEAVFIALLAGEHTSQGTIIAALLAYRMLYYFLPLLLALVCY
LMLESRAKKLRAKNQKAMAK