Protein Info for EX31_RS02790 in Rahnella sp. WP5

Annotation: low molecular weight phosphotyrosine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 6 to 139 (134 residues), 137.4 bits, E=2.3e-44

Best Hits

Swiss-Prot: 51% identical to WZB_SALTY: Low molecular weight protein-tyrosine-phosphatase Wzb (wzb) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 98% identity to rah:Rahaq_3567)

MetaCyc: 50% identical to protein-tyrosine phosphatase (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Protein Sequence (149 amino acids)

>EX31_RS02790 low molecular weight phosphotyrosine protein phosphatase (Rahnella sp. WP5)
MIFNSILVVCVGNICRSPIAEALMKQCLPEKNIQSAGLSALNGQRADHMAKMVAERHGIS
LENHKAKPFTPERGKEFDLILVMERTHINAITHSLPEIRGKIMLLGHWNQRKEIPDPYGK
DMEAFDYIFSLIKESVSGWKAALNYQGLK