Protein Info for EX31_RS02780 in Rahnella sp. WP5

Annotation: oligosaccharide flippase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details PF01943: Polysacc_synt" amino acids 7 to 265 (259 residues), 79.3 bits, see alignment E=3.4e-26 PF13440: Polysacc_synt_3" amino acids 28 to 313 (286 residues), 45 bits, see alignment E=8.7e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3565)

Predicted SEED Role

"lipopolysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>EX31_RS02780 oligosaccharide flippase family protein (Rahnella sp. WP5)
MRKIFSDSIMYVGGELIVKIFPFLLLPVLSRALGPEQYGKISLFNAYVAVFFVFIGLNAS
AAIIKYEYTQEDYNSADYFFSSVIISSVAFILCVAGVYAFYPSDIIILAAIAGYFQCIYT
NLVSINQSRKEAKKYMTAQVLNAAMSFVITLLFLYCFKVSYEIRVYAIILGFLISIFISS
WSNKNCLKQADFCFDTVKKTSSQLLLFGIPLIIHNMSFLARSGLDRIMISNYFSSSTLGN
YSASFQLSVIITVVLMALNKALTPHLYSQLKNNKISRKHFTLIFVGYFFLSTLVTILAQL
IPEGIYNLVAGEEYKDVKRFVVIMVPAFLSQGFYLIMASTCFFYGKSKAISYCTFTGGVI
HCVILFLVCKFMNVFSVPWVLFFSNSFVALLMYITVFRPVTESDQ