Protein Info for EX31_RS02775 in Rahnella sp. WP5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 264 to 297 (34 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3564)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>EX31_RS02775 hypothetical protein (Rahnella sp. WP5)
MNINFKRGVIYLCLMMLTSVCITHLIFDARDAAGGVIFTLTALSIPAITIPGARYNYLVI
AALLFSAIYTFYCINVFNIFPGIDAVRYYNFLLSNNSLSEILSGAVARMAAMHENGMTEG
PGSFFIFGVPVHIFYSLMPAKDPFYIVIFNFMFKLMSIAAMSRLFSNVSSVDFRCVLISL
IIVSPTFNYFSSVFGKDIFILFLTILLALALVDFCKTQGKVMRLFKAVVILMLAGYCFLL
RPYSPVTALLYVVFTLEYYRAMKFITLGAFFILMLAAFFKSILLIINWPMIFAFMYMAPN
PAQWMNYEGFTLLPALCVIVTIVFVLIRTIKYTTLILDSRLMSSIMCVLIYSAVMTLVGF
YAIRTDYTFGSVGDAVFRKQLLIMPLVIFSILLYLRTYASGTSDEEN