Protein Info for EX31_RS02700 in Rahnella sp. WP5

Annotation: YggU family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR00251: TIGR00251 family protein" amino acids 12 to 95 (84 residues), 95.7 bits, see alignment E=7.3e-32 PF02594: DUF167" amino acids 15 to 85 (71 residues), 92 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 85% identical to Y3359_ENT38: UPF0235 protein Ent638_3359 (Ent638_3359) from Enterobacter sp. (strain 638)

KEGG orthology group: K09131, hypothetical protein (inferred from 100% identity to rah:Rahaq_3549)

Predicted SEED Role

"COG1872"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>EX31_RS02700 YggU family protein (Rahnella sp. WP5)
MVPALSPAFWQSDALVLRLVIQPKASRDSLVGLHGDELKVAITAPPVDGQANTHLVKFLA
KQFKVAKSQVSIEKGELGRHKQVRITHPQNIPTEVAVLLAE