Protein Info for EX31_RS02575 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details amino acids 220 to 251 (32 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF12911: OppC_N" amino acids 23 to 63 (41 residues), 35.4 bits, see alignment 8e-13 PF00528: BPD_transp_1" amino acids 120 to 303 (184 residues), 112.7 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to rah:Rahaq_4711)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>EX31_RS02575 ABC transporter permease (Rahnella sp. WP5)
MASDSVHSRTAVQGKPHSAFYHTVRALLRNKFSLCGLIILGIAIVLSVLAPWISPQNPYD
LSQLDIMDGRLKPGTTSMSGMIYWLGTDDQGRDLLSAILYGTRTSLLVGVSSAMIALTIG
AALGLISAYVGGKTDALIMRIVDIQLSFPPILIALILLAVLGQGVDKIILALVVTQWAYY
ARTIRGSALLERRRSYVDAARSMALSSPRILFRHILPNCLPPLIVVATMRIAYAIMLEAT
LSFLGIGLPVTEPSLGLLIANGFDYLMSGDYWISFFPGVTLLVLIVAINLVGDALRDILN
PRNKD