Protein Info for EX31_RS02550 in Rahnella sp. WP5

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 97 to 125 (29 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details PF01554: MatE" amino acids 247 to 402 (156 residues), 40.9 bits, see alignment E=8.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4706)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>EX31_RS02550 MATE family efflux transporter (Rahnella sp. WP5)
MNTSPEMTLLRRNSLSKDIADLLKLAWPMIVVAIAVSFSQNIQTAILGHGKETSSIYLLS
MLQPFSFLFLAILECLAITNQVFSARSLNMWSRQKVLAATSLLATLGIVIVALLSGVTAL
CAPLLQTLLPVAGNAFYSSALPLYFLSMLPFIQLEMCNSALRGQGKSALSMLLVIAYIVL
NALICYTGYQVYGLGFNSIIISNALASALLIPVALWLVWRTGRHAEDDRPGAFIPRLSGL
LLQVGMPIFASLVVLFFSSLLIFPLIGTLGEQYVAGFLIVTKIRMFIVIPAVACGSALAI
LINQRLAISSGEELKRLLHRGLAFICIIYLLLTSGVYFTEVSLIKILSGDRIIQDVSSQI
LLILLPTFFMTSFVASLQALLEQLEQARRVLVLTVIIELLTVITLLVGWDKFSQLQSIMN
LIIVFNVVYFIAFGREYWRLANKIGSENVL