Protein Info for EX31_RS02535 in Rahnella sp. WP5

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF16576: HlyD_D23" amino acids 72 to 315 (244 residues), 46.8 bits, see alignment E=4.5e-16 PF13533: Biotin_lipoyl_2" amino acids 77 to 115 (39 residues), 23.3 bits, see alignment 8.7e-09 PF13437: HlyD_3" amino acids 233 to 322 (90 residues), 51.5 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4703)

Predicted SEED Role

"efflux transporter, RND family, MFP subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>EX31_RS02535 HlyD family efflux transporter periplasmic adaptor subunit (Rahnella sp. WP5)
MDISIPQPGNKFILKRYRKFIVAGALFLATLAAIYNYRFSPYQISRGSIAVGQVQYGNFS
VEVRGNGVLLPRDINWVAANVDARVEEVIYKPGMKVNKGQLLVRMSNPTLEQKLQENRLE
LDARRAETDATNAELQNKILSQEALVLDAKSRLLSSTMRLAAQKKYIAAVPMLEYETTRI
NTEQYRQQVLLEEKRLKTLKLSIDADIKASAMRLNKLESLVLLSQQEVDSLNVTSPIEGI
LQDVKVQVGQRVTTGTSIARLAKEKELYAELKVPELQSRDLAVGQQVTINTGRSQFTGVL
SRVDPAVTNGTVKVDVTFNQPLPQEARPDLSVDGLIAVTKINDSLYVERPPFAQNNLPSM
LYRLDEKERSATKMKVNFGQGSADYIQVTSGLRAGDKIILSDGSAWQGADQIEITK