Protein Info for EX31_RS02315 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 402 (391 residues), 177.8 bits, see alignment E=1.5e-56

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_4659)

Predicted SEED Role

"Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>EX31_RS02315 MFS transporter (Rahnella sp. WP5)
MSHRARVAAVYLLGFFVDLINMFIANVAYPGIAREFQAPVSALAWVSTGYILGLTLVIPL
SRWLAGRFGARRVFILSLTIFMLASLAAAAAASLTTLIGWRVLQGLGGGLLIPLGQTLTY
ALYRSHERARLSAVIMLVGLLAPALSPALGGIIVDSFSWRWVFIASLPLSSLAWVLALCW
LPQTPREPAGRFDLKGFALLNGGLALVLWGLTSLGENSEWLSGSALFVAGAGLMTMFVRA
SRKHPEPLLDLTLIKDPLLRTGMLIYQCIPGVFTGVSLIAMLYLQNEHHFSAAQSGGLML
PWSLASFAAISFTGKMFNRLGPRALFIPGCLIQGAGIGLLALLSVFPAAPWLAIAAFTLM
GAGSSLCSSTAQSAAFLHIRTEQLADASALWNINRQLSFCLGVTLVSVMLSAWQLSVPAF
AYPLSFTVAASSVIIPIMLCLRLPGHAIIQERLLQEHQQEKL